Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d2zchl2: 2zch L:108-211 [198797] Other proteins in same PDB: d2zchh1, d2zchh2, d2zchl1, d2zchp_ automated match to d1c12a2 complexed with cl, ndg, po4 |
PDB Entry: 2zch (more details), 2.83 Å
SCOPe Domain Sequences for d2zchl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zchl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d2zchl2: