Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab 50.1 (mouse), kappa L chain [48772] (3 PDB entries) |
Domain d1ggij1: 1ggi J:1-112 [19879] Other proteins in same PDB: d1ggih2, d1ggij2, d1ggil2, d1ggim2 |
PDB Entry: 1ggi (more details), 2.8 Å
SCOP Domain Sequences for d1ggij1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggij1 b.1.1.1 (J:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 50.1 (mouse), kappa L chain} qvqlkesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvs
Timeline for d1ggij1: