SCOP 1.55: Domain d1ggij1: 1ggi J:1-112

Lineage for d1ggij1 (1ggi J:1-112)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 50.1 (mouse), kappa L chain [48772] (3 PDB entries)

8. Domain d1ggij1: 1ggi J:1-112 [19879]
   Other proteins in same PDB: d1ggih2, d1ggij2, d1ggil2, d1ggim2

Details for d1ggij1

PDB Entry: 1ggi, 2.8 Å

PDB Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen

SCOP Domain Sequences for d1ggij1:

Sequence; same for both SEQRES and ATOM records:

>d1ggij1 b.1.1.1 (J:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 50.1 (mouse), kappa L chain}
qvqlkesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvs

Timeline for d1ggij1:

• d1ggij1 appears in SCOP 1.57
  
• d1ggij1 appears in the current release, SCOPe 2.08