SCOPe 2.04: Domain d2yvja2: 2yvj A:116-236

Lineage for d2yvja2 (2yvj A:116-236)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein NADH-dependent ferredoxin reductase, BphA4 [51957] (1 species)

7. Species Pseudomonas sp., KKS102 [TaxId:306] [51958] (9 PDB entries)

8. Domain d2yvja2: 2yvj A:116-236 [198780]
   Other proteins in same PDB: d2yvja3, d2yvjb_, d2yvjp3
   automated match to d1d7ya2
   complexed with fad, fes, nai

Details for d2yvja2

PDB Entry: 2yvj, 1.9 Å

PDB Description: Crystal structure of the ferredoxin-ferredoxin reductase (BPHA3-BPHA4)complex

PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d2yvja2:

Sequence; same for both SEQRES and ATOM records:

>d2yvja2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
lptlqgatmpvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslve
tqprlmsraapatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgi
g

Timeline for d2yvja2:

• d2yvja2 first appeared in SCOPe 2.03
  
• d2yvja2 appears in SCOPe 2.05
  
• d2yvja2 appears in the current release, SCOPe 2.08