Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein NADH-dependent ferredoxin reductase, BphA4 [51957] (1 species) |
Species Pseudomonas sp., KKS102 [TaxId:306] [51958] (9 PDB entries) |
Domain d2yvja1: 2yvj A:5-115,A:237-308 [198779] Other proteins in same PDB: d2yvja3, d2yvja4, d2yvjb_, d2yvjp3, d2yvjp4 automated match to d1d7ya1 complexed with fad, fes, nai |
PDB Entry: 2yvj (more details), 1.9 Å
SCOPe Domain Sequences for d2yvja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvja1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} alkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgdaeki rldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapraXvlandala raaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgiavarh lvdp
Timeline for d2yvja1: