Lineage for d1ggih1 (1ggi H:1-112)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511260Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
    SQ NA # part of Fab 28 against HIV-1 RT
  8. 1511265Domain d1ggih1: 1ggi H:1-112 [19877]
    Other proteins in same PDB: d1ggih2, d1ggij2, d1ggil1, d1ggil2, d1ggim1, d1ggim2
    part of Fab 50.1

Details for d1ggih1

PDB Entry: 1ggi (more details), 2.8 Å

PDB Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen
PDB Compounds: (H:) igg2a 50.1 fab (heavy chain)

SCOPe Domain Sequences for d1ggih1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggih1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qvqlkesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvs

SCOPe Domain Coordinates for d1ggih1:

Click to download the PDB-style file with coordinates for d1ggih1.
(The format of our PDB-style files is described here.)

Timeline for d1ggih1: