SCOPe 2.05: Domain d2yowb_: 2yow B:

Lineage for d2yowb_ (2yow B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Bacillus amyloliquefaciens [TaxId:1390] [197052] (3 PDB entries)

8. Domain d2yowb_: 2yow B: [198768]
   automated match to d2yowa_

Details for d2yowb_

PDB Entry: 2yow, 1.8 Å

PDB Description: Bacillus amyloliquefaciens CBM33

PDB Compounds: (B:) rbam17540

SCOPe Domain Sequences for d2yowb_:

Sequence; same for both SEQRES and ATOM records:

>d2yowb_ b.1.18.0 (B:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt

Timeline for d2yowb_:

• d2yowb_ first appeared in SCOPe 2.03
  
• d2yowb_ appears in SCOPe 2.04
  
• d2yowb_ appears in SCOPe 2.06
  
• d2yowb_ appears in the current release, SCOPe 2.08