SCOPe 2.01: Domain d1ggil1: 1ggi L:1-107

Lineage for d1ggil1 (1ggi L:1-107)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)
Domain d1ggil1: 1ggi L:1-107 [19876]
Other proteins in same PDB: d1ggih1, d1ggih2, d1ggij1, d1ggij2, d1ggil2, d1ggim2
part of Fab 50.1

Details for d1ggil1

PDB Entry: 1ggi (more details), 2.8 Å

PDB Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen

PDB Compounds: (L:) igg2a 50.1 fab (light chain)

SCOPe Domain Sequences for d1ggil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggil1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleik

SCOPe Domain Coordinates for d1ggil1:

Click to download the PDB-style file with coordinates for d1ggil1.
(The format of our PDB-style files is described here.)

Timeline for d1ggil1: