Lineage for d2yflk1 (2yfl K:18-179)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782562Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2782563Protein automated matches [190701] (13 species)
    not a true protein
  7. 2782569Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries)
  8. 2782641Domain d2yflk1: 2yfl K:18-179 [198752]
    Other proteins in same PDB: d2yfla2, d2yflb_, d2yflc2, d2yfld_, d2yfle2, d2yflf_, d2yflg2, d2yflh_, d2yfli2, d2yflj_, d2yflk2, d2yfll_
    automated match to d1wqla1
    complexed with dc4, fe2, fes

Details for d2yflk1

PDB Entry: 2yfl (more details), 2.6 Å

PDB Description: Crystal Structure of Biphenyl dioxygenase variant RR41 with 2-chloro dibenzofuran
PDB Compounds: (K:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yflk1:

Sequence, based on SEQRES records: (download)

>d2yflk1 b.33.1.0 (K:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records): (download)

>d2yflk1 b.33.1.0 (K:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

SCOPe Domain Coordinates for d2yflk1:

Click to download the PDB-style file with coordinates for d2yflk1.
(The format of our PDB-style files is described here.)

Timeline for d2yflk1: