Lineage for d1ggbh1 (1ggb H:1-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756475Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
    SQ NA # part of Fab 28 against HIV-1 RT
  8. 1756478Domain d1ggbh1: 1ggb H:1-112 [19875]
    Other proteins in same PDB: d1ggbh2, d1ggbl1, d1ggbl2
    part of Fab 50.1

Details for d1ggbh1

PDB Entry: 1ggb (more details), 2.8 Å

PDB Description: major antigen-induced domain rearrangements in an antibody
PDB Compounds: (H:) igg2a-kappa 50.1 fab (heavy chain)

SCOPe Domain Sequences for d1ggbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggbh1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qvqlqesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvs

SCOPe Domain Coordinates for d1ggbh1:

Click to download the PDB-style file with coordinates for d1ggbh1.
(The format of our PDB-style files is described here.)

Timeline for d1ggbh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggbh2