Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab 4D5 (synthetic, humanised version), kappa L chain [48771] (3 PDB entries) |
Domain d1fved1: 1fve D:1-121 [19873] Other proteins in same PDB: d1fvea2, d1fveb2, d1fvec2, d1fved2 |
PDB Entry: 1fve (more details), 2.7 Å
SCOP Domain Sequences for d1fved1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fved1 b.1.1.1 (D:1-121) Immunoglobulin (variable domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain} evqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytry adsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdywgqgtlvtvss a
Timeline for d1fved1: