SCOPe 2.03: Domain d2yfie1: 2yfi E:18-179

Lineage for d2yfie1 (2yfi E:18-179)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (8 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226023] (6 PDB entries)

8. Domain d2yfie1: 2yfi E:18-179 [198722]
   Other proteins in same PDB: d2yfia2, d2yfib_, d2yfic2, d2yfid_, d2yfie2, d2yfif_, d2yfig2, d2yfih_, d2yfii2, d2yfij_, d2yfik2, d2yfil_
   automated match to d1wqla1
   complexed with fe2, fes

Details for d2yfie1

PDB Entry: 2yfi, 2.15 Å

PDB Description: crystal structure of biphenyl dioxygenase variant rr41 (bpdo-rr41)

PDB Compounds: (E:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2yfie1:

Sequence, based on SEQRES records:

>d2yfie1 b.33.1.0 (E:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records):

>d2yfie1 b.33.1.0 (E:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

Timeline for d2yfie1:

• d2yfie1 is new in SCOPe 2.03-stable
  
• d2yfie1 appears in SCOPe 2.04
  
• d2yfie1 appears in the current release, SCOPe 2.08