SCOPe 2.03: Domain d2yf6a2: 2yf6 A:178-277

Lineage for d2yf6a2 (2yf6 A:178-277)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (13 PDB entries)

8. Domain d2yf6a2: 2yf6 A:178-277 [198717]
   Other proteins in same PDB: d2yf6a1
   automated match to d1de4a1

Details for d2yf6a2

PDB Entry: 2yf6, 2.8 Å

PDB Description: complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide

PDB Compounds: (A:) Major histocompatibility complex class I glycoprotein haplotype B21

SCOPe Domain Sequences for d2yf6a2:

Sequence; same for both SEQRES and ATOM records:

>d2yf6a2 b.1.1.0 (A:178-277) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rrerpevrvwgkeadgiltlscrahgfyprpivvswlkdgavrgqdaqsggivpngdgty
htwvtidaqpgdgdkyqcrvehaslpqpglyswrsgggln

Timeline for d2yf6a2:

• d2yf6a2 is new in SCOPe 2.03-stable
  
• d2yf6a2 appears in SCOPe 2.04
  
• d2yf6a2 last appears in SCOPe 2.05