Lineage for d2yf5a2 (2yf5 A:178-277)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295810Species Chicken (Gallus gallus) [TaxId:9031] [188287] (13 PDB entries)
  8. 1295835Domain d2yf5a2: 2yf5 A:178-277 [198715]
    Other proteins in same PDB: d2yf5a1
    automated match to d1de4a1
    complexed with edo

Details for d2yf5a2

PDB Entry: 2yf5 (more details), 2.82 Å

PDB Description: complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
PDB Compounds: (A:) Major histocompatibility complex class I glycoprotein haplotype B21

SCOPe Domain Sequences for d2yf5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yf5a2 b.1.1.0 (A:178-277) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rrerpevrvwgkeadgiltlscrahgfyprpivvswlkdgavrgqdaqsggivpngdgty
htwvtidaqpgdgdkyqcrvehaslpqpglyswrsgggln

SCOPe Domain Coordinates for d2yf5a2:

Click to download the PDB-style file with coordinates for d2yf5a2.
(The format of our PDB-style files is described here.)

Timeline for d2yf5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yf5a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2yf5b_