Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225828] (8 PDB entries) |
Domain d2yf5a1: 2yf5 A:1-177 [198714] Other proteins in same PDB: d2yf5a2, d2yf5b_ automated match to d1de4a2 complexed with edo |
PDB Entry: 2yf5 (more details), 2.82 Å
SCOPe Domain Sequences for d2yf5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yf5a1 d.19.1.0 (A:1-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} elhtlryirtamtdpgpglpwfvdvgyvdgelfmhynstarravprtewiaantdqqywd retqivqgseqinrenldilrrrynqtggshtvqwmsgcdiledgtirgyhqaaydgrdf vafdkgtmtltaavpeavptkrkweeggyaeglkqyleetcvewlrryveygkaelg
Timeline for d2yf5a1: