SCOPe 2.04: Domain d2yc1d_: 2yc1 D:

Lineage for d2yc1d_ (2yc1 D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)

8. Domain d2yc1d_: 2yc1 D: [198710]
   Other proteins in same PDB: d2yc1b_, d2yc1c_, d2yc1e_, d2yc1f_
   automated match to d3ogoh_
   complexed with gol

Details for d2yc1d_

PDB Entry: 2yc1, 1.9 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann

PDB Compounds: (D:) single chain antibody fragment 9004g

SCOPe Domain Sequences for d2yc1d_:

Sequence; same for both SEQRES and ATOM records:

>d2yc1d_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlsctgsgftfdnyamhwlrqvpgeglewvsgisrssgdidy
adsvkgrftisrddakktlslqmnslraedtavyycarggvgsfdtwgqgtmvtvss

Timeline for d2yc1d_:

• d2yc1d_ first appeared in SCOPe 2.03
  
• d2yc1d_ appears in SCOPe 2.05
  
• d2yc1d_ appears in the current release, SCOPe 2.08