Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab 4D5 (synthetic, humanised version), kappa L chain [48771] (3 PDB entries) |
Domain d1fveb1: 1fve B:1-120 [19871] Other proteins in same PDB: d1fvea2, d1fveb2, d1fvec2, d1fved2 |
PDB Entry: 1fve (more details), 2.7 Å
SCOP Domain Sequences for d1fveb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fveb1 b.1.1.1 (B:1-120) Immunoglobulin (variable domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain} evqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytry adsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdywgqgtlvtvss
Timeline for d1fveb1: