SCOPe 2.07: Domain d2yc1b_: 2yc1 B:

Lineage for d2yc1b_ (2yc1 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2yc1b_: 2yc1 B: [198709]
   Other proteins in same PDB: d2yc1a_, d2yc1c_, d2yc1d_, d2yc1f_
   automated match to d4jvpa_
   complexed with gol

Details for d2yc1b_

PDB Entry: 2yc1, 1.9 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann

PDB Compounds: (B:) single chain antibody fragment 9004g

SCOPe Domain Sequences for d2yc1b_:

Sequence; same for both SEQRES and ATOM records:

>d2yc1b_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqaprllfsdasnratgip
arftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkveik

Timeline for d2yc1b_:

• d2yc1b_ first appeared in SCOPe 2.03
  
• d2yc1b_ appears in SCOPe 2.06
  
• d2yc1b_ appears in the current release, SCOPe 2.08, called d2yc1b1