Lineage for d2ybrh1 (2ybr H:133-240)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755812Domain d2ybrh1: 2ybr H:133-240 [198707]
    Other proteins in same PDB: d2ybra_, d2ybrb2, d2ybrc_, d2ybrd_, d2ybre2, d2ybrf_, d2ybrg_, d2ybrh2, d2ybri_
    automated match to d4jvpa_

Details for d2ybrh1

PDB Entry: 2ybr (more details), 2.55 Å

PDB Description: crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
PDB Compounds: (H:) single chain antibody fragment 9004g

SCOPe Domain Sequences for d2ybrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ybrh1 b.1.1.0 (H:133-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlsvspgeratlscrasqsvrsylawyqqkpgqaprllfsdasnratgipa
rftgsgsgtdftltisslepedfaiyycqqyrysprtfgqgtkveikr

SCOPe Domain Coordinates for d2ybrh1:

Click to download the PDB-style file with coordinates for d2ybrh1.
(The format of our PDB-style files is described here.)

Timeline for d2ybrh1: