| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
| Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
| Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries) Uniprot P80385 182-326! Uniprot P80385 23-181 |
| Domain d2ya3e1: 2ya3 E:25-181 [198695] Other proteins in same PDB: d2ya3a1, d2ya3a2, d2ya3a3, d2ya3b_ automated match to d2v8qe2 complexed with amp, j7v |
PDB Entry: 2ya3 (more details), 2.5 Å
SCOPe Domain Sequences for d2ya3e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ya3e1 d.37.1.1 (E:25-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssvyttfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvgm
ltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavssl
irnkihrlpvidpesgntlyilthkrilkflklfite
Timeline for d2ya3e1:
View in 3DDomains from other chains: (mouse over for more information) d2ya3a1, d2ya3a2, d2ya3a3, d2ya3b_ |