SCOP 1.67: Domain d1fvdc1: 1fvd C:1-107

Lineage for d1fvdc1 (1fvd C:1-107)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Engineered (including hybrid species) [88533] (27 PDB entries)
Domain d1fvdc1: 1fvd C:1-107 [19868]
Other proteins in same PDB: d1fvda2, d1fvdb1, d1fvdb2, d1fvdc2, d1fvdd1, d1fvdd2
part of humanized Fab 4D5, herceptin

Details for d1fvdc1

PDB Entry: 1fvd (more details), 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvdc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik

SCOP Domain Coordinates for d1fvdc1:

Click to download the PDB-style file with coordinates for d1fvdc1.
(The format of our PDB-style files is described here.)

Timeline for d1fvdc1: