![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab 4D5 (synthetic, humanised version), kappa L chain [48771] (3 PDB entries) |
![]() | Domain d1fvdc1: 1fvd C:1-114 [19868] Other proteins in same PDB: d1fvda2, d1fvdb2, d1fvdc2, d1fvdd2 |
PDB Entry: 1fvd (more details), 2.5 Å
SCOP Domain Sequences for d1fvdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvdc1 b.1.1.1 (C:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain} diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikrtvaaps
Timeline for d1fvdc1: