Lineage for d1fvdc1 (1fvd C:1-114)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7436Species Fab 4D5 (synthetic, humanised version), kappa L chain [48771] (3 PDB entries)
  8. 7443Domain d1fvdc1: 1fvd C:1-114 [19868]
    Other proteins in same PDB: d1fvda2, d1fvdb2, d1fvdc2, d1fvdd2

Details for d1fvdc1

PDB Entry: 1fvd (more details), 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvdc1 b.1.1.1 (C:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikrtvaaps

SCOP Domain Coordinates for d1fvdc1:

Click to download the PDB-style file with coordinates for d1fvdc1.
(The format of our PDB-style files is described here.)

Timeline for d1fvdc1: