SCOPe 2.05: Domain d2y69d_: 2y69 D:

Lineage for d2y69d_ (2y69 D:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)
   automatically mapped to Pfam PF02936

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)

6. Protein automated matches [190270] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187062] (18 PDB entries)

8. Domain d2y69d_: 2y69 D: [198670]
   Other proteins in same PDB: d2y69a_, d2y69b1, d2y69b2, d2y69c_, d2y69e_, d2y69f_, d2y69g_, d2y69h_, d2y69i_, d2y69j_, d2y69k_, d2y69l_, d2y69m_, d2y69n_, d2y69o1, d2y69o2, d2y69p_, d2y69r_, d2y69s_, d2y69t_, d2y69u_, d2y69v_, d2y69w_, d2y69x_, d2y69y_, d2y69z_
   automated match to d1v54d_
   complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69d_

PDB Entry: 2y69, 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen

PDB Compounds: (D:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d2y69d_:

Sequence; same for both SEQRES and ATOM records:

>d2y69d_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d2y69d_:

• d2y69d_ first appeared in SCOPe 2.03
  
• d2y69d_ appears in SCOPe 2.04
  
• d2y69d_ appears in SCOPe 2.06
  
• d2y69d_ appears in the current release, SCOPe 2.08