SCOPe 2.06: Domain d2xv6c_: 2xv6 C:

Lineage for d2xv6c_ (2xv6 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein automated matches [226861] (4 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries)

8. Domain d2xv6c_: 2xv6 C: [198665]
   Other proteins in same PDB: d2xv6b1, d2xv6b2, d2xv6d1, d2xv6d2
   automated match to d1baja_

Details for d2xv6c_

PDB Entry: 2xv6, 1.89 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.

PDB Compounds: (C:) capsid protein p24

SCOPe Domain Sequences for d2xv6c_:

Sequence, based on SEQRES records:

>d2xv6c_ a.28.3.1 (C:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtac

Sequence, based on observed residues (ATOM records):

>d2xv6c_ a.28.3.1 (C:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalat
leemmtac

Timeline for d2xv6c_:

• d2xv6c_ first appeared in SCOPe 2.03
  
• d2xv6c_ appears in SCOPe 2.05
  
• d2xv6c_ appears in SCOPe 2.07
  
• d2xv6c_ appears in the current release, SCOPe 2.08