SCOPe 2.03: Domain d2xrxk2: 2xrx K:180-459

Lineage for d2xrxk2 (2xrx K:180-459)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (13 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226024] (6 PDB entries)

8. Domain d2xrxk2: 2xrx K:180-459 [198649]
   Other proteins in same PDB: d2xrxa1, d2xrxb_, d2xrxc1, d2xrxd_, d2xrxe1, d2xrxf_, d2xrxg1, d2xrxh_, d2xrxi1, d2xrxj_, d2xrxk1, d2xrxl_, d2xrxm1, d2xrxn_, d2xrxo1, d2xrxp_, d2xrxq1, d2xrxr_, d2xrxs1, d2xrxt_, d2xrxu1, d2xrxv_, d2xrxw1, d2xrxx_
   automated match to d1wqla2
   complexed with bnl, fe2, fes

Details for d2xrxk2

PDB Entry: 2xrx, 2.42 Å

PDB Description: crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400

PDB Compounds: (K:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xrxk2:

Sequence; same for both SEQRES and ATOM records:

>d2xrxk2 d.129.3.0 (K:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

Timeline for d2xrxk2:

• d2xrxk2 is new in SCOPe 2.03-stable
  
• d2xrxk2 appears in SCOPe 2.04
  
• d2xrxk2 appears in the current release, SCOPe 2.08