Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries) |
Domain d2xrxc2: 2xrx C:180-459 [198641] Other proteins in same PDB: d2xrxa1, d2xrxb_, d2xrxc1, d2xrxd_, d2xrxe1, d2xrxf_, d2xrxg1, d2xrxh_, d2xrxi1, d2xrxj_, d2xrxk1, d2xrxl_, d2xrxm1, d2xrxn_, d2xrxo1, d2xrxp_, d2xrxq1, d2xrxr_, d2xrxs1, d2xrxt_, d2xrxu1, d2xrxv_, d2xrxw1, d2xrxx_ automated match to d1wqla2 complexed with bnl, fe2, fes |
PDB Entry: 2xrx (more details), 2.42 Å
SCOPe Domain Sequences for d2xrxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xrxc2 d.129.3.0 (C:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]} apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg paaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvd adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
Timeline for d2xrxc2:
View in 3D Domains from other chains: (mouse over for more information) d2xrxa1, d2xrxa2, d2xrxb_, d2xrxd_, d2xrxe1, d2xrxe2, d2xrxf_, d2xrxg1, d2xrxg2, d2xrxh_, d2xrxi1, d2xrxi2, d2xrxj_, d2xrxk1, d2xrxk2, d2xrxl_, d2xrxm1, d2xrxm2, d2xrxn_, d2xrxo1, d2xrxo2, d2xrxp_, d2xrxq1, d2xrxq2, d2xrxr_, d2xrxs1, d2xrxs2, d2xrxt_, d2xrxu1, d2xrxu2, d2xrxv_, d2xrxw1, d2xrxw2, d2xrxx_ |