SCOP 1.71: Domain d1fvcc_: 1fvc C:

Lineage for d1fvcc_ (1fvc C:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (52 PDB entries)

8. Domain d1fvcc_: 1fvc C: [19864]
   Other proteins in same PDB: d1fvcb_, d1fvcd_
   part of humanized Fv 4D5, herceptin

Details for d1fvcc_

PDB Entry: 1fvc, 2.2 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvcc_:

Sequence; same for both SEQRES and ATOM records:

>d1fvcc_ b.1.1.1 (C:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflysgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikr

Timeline for d1fvcc_:

• d1fvcc_ first appeared (with stable ids) in SCOP 1.55
  
• d1fvcc_ appears in SCOP 1.69
  
• d1fvcc_ appears in SCOP 1.73
  
• d1fvcc_ appears in the current release, SCOPe 2.08