Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (21 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries) |
Domain d2xr8m2: 2xr8 M:180-459 [198627] Other proteins in same PDB: d2xr8a1, d2xr8b_, d2xr8c1, d2xr8d_, d2xr8e1, d2xr8f_, d2xr8g1, d2xr8h_, d2xr8i1, d2xr8j_, d2xr8k1, d2xr8l_, d2xr8m1, d2xr8n_, d2xr8o1, d2xr8p_, d2xr8q1, d2xr8r_, d2xr8s1, d2xr8t_, d2xr8u1, d2xr8v_, d2xr8w1, d2xr8x_ automated match to d1wqla2 complexed with fe2, fes |
PDB Entry: 2xr8 (more details), 2.49 Å
SCOPe Domain Sequences for d2xr8m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xr8m2 d.129.3.0 (M:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]} apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg paaelaeqrlghtgmpvrrmvgqhmtifptcsflptfnniriwhprgpneievwaftlvd adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
Timeline for d2xr8m2:
View in 3D Domains from other chains: (mouse over for more information) d2xr8a1, d2xr8a2, d2xr8b_, d2xr8c1, d2xr8c2, d2xr8d_, d2xr8e1, d2xr8e2, d2xr8f_, d2xr8g1, d2xr8g2, d2xr8h_, d2xr8i1, d2xr8i2, d2xr8j_, d2xr8k1, d2xr8k2, d2xr8l_, d2xr8n_, d2xr8o1, d2xr8o2, d2xr8p_, d2xr8q1, d2xr8q2, d2xr8r_, d2xr8s1, d2xr8s2, d2xr8t_, d2xr8u1, d2xr8u2, d2xr8v_, d2xr8w1, d2xr8w2, d2xr8x_ |