SCOP 1.71: Domain d1fvca_: 1fvc A:

Lineage for d1fvca_ (1fvc A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (52 PDB entries)

8. Domain d1fvca_: 1fvc A: [19862]
   Other proteins in same PDB: d1fvcb_, d1fvcd_

Details for d1fvca_

PDB Entry: 1fvc, 2.2 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvca_:

Sequence; same for both SEQRES and ATOM records:

>d1fvca_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflysgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikrt

Timeline for d1fvca_:

• d1fvca_ first appeared (with stable ids) in SCOP 1.55
  
• d1fvca_ appears in SCOP 1.69
  
• d1fvca_ appears in SCOP 1.73
  
• d1fvca_ appears in the current release, SCOPe 2.08