SCOPe 2.04: Domain d2xqbl1: 2xqb L:5-107

Lineage for d2xqbl1 (2xqb L:5-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2xqbl1: 2xqb L:5-107 [198611]
   Other proteins in same PDB: d2xqba_, d2xqbl2
   automated match to d1adql1
   complexed with so4

Details for d2xqbl1

PDB Entry: 2xqb, 2.6 Å

PDB Description: crystal structure of anti-il-15 antibody in complex with human il-15

PDB Compounds: (L:) anti-il-15 antibody

SCOPe Domain Sequences for d2xqbl1:

Sequence, based on SEQRES records:

>d2xqbl1 b.1.1.0 (L:5-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqppsasgtpgqrvtiscsgstsnlkrnyvywyqqlpgtapklliyrdrrrpsgvpdrfs
gsksgtsaslaisglrsedeadyycawydrelsewvfgggtkltvl

Sequence, based on observed residues (ATOM records):

>d2xqbl1 b.1.1.0 (L:5-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqppsasgtpgqrvtiscsgstnyvywyqqlpgtapklliyrdrrrpsgvpdrfsgsksg
tsaslaisglrsedeadyycawydrelsewvfgggtkltvl

Timeline for d2xqbl1:

• d2xqbl1 first appeared in SCOPe 2.03
  
• d2xqbl1 appears in SCOPe 2.05
  
• d2xqbl1 appears in the current release, SCOPe 2.08