SCOP 1.65: Domain d2mcph1: 2mcp H:1-121

Lineage for d2mcph1 (2mcp H:1-121)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (22 PDB entries)

8. Domain d2mcph1: 2mcp H:1-121 [19861]
   Other proteins in same PDB: d2mcph2, d2mcpl1, d2mcpl2
   part of Fab MCPC603
   complexed with pc

Details for d2mcph1

PDB Entry: 2mcp, 3.1 Å

PDB Description: refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution

SCOP Domain Sequences for d2mcph1:

Sequence; same for both SEQRES and ATOM records:

>d2mcph1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt
eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv
s

Timeline for d2mcph1:

• d2mcph1 first appeared (with stable ids) in SCOP 1.55
  
• d2mcph1 appears in SCOP 1.63
  
• d2mcph1 appears in SCOP 1.67
  
• d2mcph1 appears in the current release, SCOPe 2.08