Lineage for d2xhya_ (2xhy A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1341162Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1341163Protein automated matches [190075] (46 species)
    not a true protein
  7. 1341214Species Escherichia coli [TaxId:83333] [193700] (1 PDB entry)
  8. 1341215Domain d2xhya_: 2xhy A: [198607]
    automated match to d2xhyb_
    complexed with br, so4

Details for d2xhya_

PDB Entry: 2xhy (more details), 2.3 Å

PDB Description: Crystal Structure of E.coli BglA
PDB Compounds: (A:) 6-phospho-beta-glucosidase bgla

SCOPe Domain Sequences for d2xhya_:

Sequence, based on SEQRES records: (download)

>d2xhya_ c.1.8.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
kkltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgkyypn
heavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfdellk
yniepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfneinn
qrnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgcmla
mvplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgdldv
lregtcdylgfsyymtnavkaeggtgdaisgfegsvpnpyvkasdwgwqidpvglryalc
elyeryqrplfivengfgaydkveedgsinddyridylrahieemkkavtydgvdlmgyt
pwgcidcvsfttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl

Sequence, based on observed residues (ATOM records): (download)

>d2xhya_ c.1.8.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
kkltlpkdflwggavaahqveggwnkggkgpsicdvltggahgvpreitkevlpgkyypn
heavdfyghykediklfaemgfkcfrtsiawtrifpkgdeaqpneeglkfyddmfdellk
yniepvitlshfemplhlvqqygswtnrkvvdffvrfaevvferykhkvkywmtfneinn
qrnwraplfgyccsgvvytehenpeetmyqvlhhqfvasalavkaarrinpemkvgcmla
mvplypyscnpddvmfaqesmreryvftdvqlrgyypsyvlnewerrgfnikmedgdldv
lregtcdylgfsyymtnavkaeggtfegsvpnpyvkasdwgwqidpvglryalcelyery
qrplfivengfgaydkveedgsinddyridylrahieemkkavtydgvdlmgytpwgcid
cvsfttgqyskrygfiyvnkhddgtgdmsrsrkksfnwykeviasngekl

SCOPe Domain Coordinates for d2xhya_:

Click to download the PDB-style file with coordinates for d2xhya_.
(The format of our PDB-style files is described here.)

Timeline for d2xhya_: