![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (4 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [225910] (2 PDB entries) |
![]() | Domain d2xfxa1: 2xfx A:1-181 [198604] Other proteins in same PDB: d2xfxa2, d2xfxa3, d2xfxb_ automated match to d1xh3a2 |
PDB Entry: 2xfx (more details), 1.9 Å
SCOPe Domain Sequences for d2xfxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xfxa1 d.19.1.1 (A:1-181) automated matches {Cow (Bos taurus) [TaxId: 9913]} gshslryfhtavsrpglreplfitvgyvddtqfvrfdsdardprteprqpwmekegpeyw dretqiskenalwyrealnnlrgyynqseagshtlqemygcdvgsdgrlrrgyeqygydg rdylalnedlrswtaadtaaqiskrkmeaagaaerfrnylegtcvewlrrylengkdtll r
Timeline for d2xfxa1: