![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab MCPC603 (human), kappa L chain [48770] (4 PDB entries) |
![]() | Domain d2mcpl1: 2mcp L:1-114 [19860] Other proteins in same PDB: d2mcph2, d2mcpl2 |
PDB Entry: 2mcp (more details), 3.1 Å
SCOP Domain Sequences for d2mcpl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mcpl1 b.1.1.1 (L:1-114) Immunoglobulin (variable domains of L and H chains) {Fab MCPC603 (human), kappa L chain} divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikr
Timeline for d2mcpl1: