SCOP 1.61: Domain d1mcph1: 1mcp H:1-121

Lineage for d1mcph1 (1mcp H:1-121)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab MCPC603 (human), kappa L chain [48770] (4 PDB entries)

8. Domain d1mcph1: 1mcp H:1-121 [19859]
   Other proteins in same PDB: d1mcph2, d1mcpl2

Details for d1mcph1

PDB Entry: 1mcp, 2.7 Å

PDB Description: phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms

SCOP Domain Sequences for d1mcph1:

Sequence; same for both SEQRES and ATOM records:

>d1mcph1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab MCPC603 (human), kappa L chain}
evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt
eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv
s

Timeline for d1mcph1:

• d1mcph1 first appeared (with stable ids) in SCOP 1.55
  
• d1mcph1 appears in SCOP 1.59
  
• d1mcph1 appears in SCOP 1.63
  
• d1mcph1 appears in the current release, SCOPe 2.08