SCOP 1.63: Domain d1mcpl1: 1mcp L:1-114

Lineage for d1mcpl1 (1mcp L:1-114)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab MCPC603 (human), kappa L chain [48770] (4 PDB entries)

8. Domain d1mcpl1: 1mcp L:1-114 [19858]
   Other proteins in same PDB: d1mcph2, d1mcpl2

Details for d1mcpl1

PDB Entry: 1mcp, 2.7 Å

PDB Description: phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms

SCOP Domain Sequences for d1mcpl1:

Sequence; same for both SEQRES and ATOM records:

>d1mcpl1 b.1.1.1 (L:1-114) Immunoglobulin (variable domains of L and H chains) {Fab MCPC603 (human), kappa L chain}
divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikr

Timeline for d1mcpl1:

• d1mcpl1 first appeared (with stable ids) in SCOP 1.55
  
• d1mcpl1 appears in SCOP 1.61
  
• d1mcpl1 appears in SCOP 1.65
  
• d1mcpl1 appears in the current release, SCOPe 2.08