Lineage for d2wu5e1 (2wu5 E:1-235,E:356-450)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1581823Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1581824Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1582239Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 1582308Protein Succinate dehydogenase [82311] (2 species)
  7. 1582309Species Escherichia coli [TaxId:562] [82312] (6 PDB entries)
  8. 1582320Domain d2wu5e1: 2wu5 E:1-235,E:356-450 [198577]
    Other proteins in same PDB: d2wu5a2, d2wu5a3, d2wu5b1, d2wu5b2, d2wu5c_, d2wu5e2, d2wu5e3, d2wu5f1, d2wu5f2, d2wu5g_, d2wu5i2, d2wu5i3, d2wu5j1, d2wu5j2, d2wu5k_
    automated match to d1neka2
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu5e1

PDB Entry: 2wu5 (more details), 2.8 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant
PDB Compounds: (E:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wu5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu5e1 c.3.1.4 (E:1-235,E:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mklpvrefdavvigaggagmraalqisqsgqtcallskvfptrshtvsaqggitvalgnt
hednwewhmydtvkgsdyigdqdaieymcktgpeailelehmglpfsrlddgriyqrpfg
gqsknfggeqaartaaaadrtghallhtlyqqnlknhttifsewyaldlvknqdgavvgc
talcietgevvyfkaratvlatggagriyqsttnahintgdgvgmairagvpvqdXmmgg
iptkvtgqaltvnekgedvvvpglfavgeiacvsvhganrlggnslldlvvfgraaglhl
qesiaeqgalrdasesdveasldrlnrwnnn

SCOPe Domain Coordinates for d2wu5e1:

Click to download the PDB-style file with coordinates for d2wu5e1.
(The format of our PDB-style files is described here.)

Timeline for d2wu5e1: