Lineage for d2imm__ (2imm -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) 
Species Fab MCPC603 (human), kappa L chain [48770] (4 PDB entries) 
Domain d2imm__: 2imm - [19857]
Details for d2imm__
PDB Entry: 2imm (more details), 2 Å
PDB Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant
SCOP Domain Sequences for d2imm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2imm__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Fab MCPC603 (human), kappa L chain}
divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr
SCOP Domain Coordinates for d2imm__:
Click to download the PDB-style file with coordinates for d2imm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2imm__:
- d2imm__ first appeared (with stable ids) in SCOP 1.55
- d2imm__ appears in SCOP 1.57
- d2imm__ appears in SCOP 1.61
- d2imm__ appears in the current release, SCOPe 2.08, called d2imma_
View in 3D