Lineage for d2imm__ (2imm -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7777Species Fab MCPC603 (human), kappa L chain [48770] (4 PDB entries)
  8. 7779Domain d2imm__: 2imm - [19857]

Details for d2imm__

PDB Entry: 2imm (more details), 2 Å

PDB Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant

SCOP Domain Sequences for d2imm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imm__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Fab MCPC603 (human), kappa L chain}
divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr

SCOP Domain Coordinates for d2imm__:

Click to download the PDB-style file with coordinates for d2imm__.
(The format of our PDB-style files is described here.)

Timeline for d2imm__: