Lineage for d2imn__ (2imn -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Fab MCPC603 (human), kappa L chain [48770] (4 PDB entries) 
Domain d2imn__: 2imn - [19856]
Details for d2imn__
PDB Entry: 2imn (more details), 1.97 Å
PDB Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant
SCOP Domain Sequences for d2imn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2imn__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Fab MCPC603 (human), kappa L chain}
divmtqspsslsvsagervtmsckssqsllykdgknflawyqqkpgqppklliygastre
sgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr
SCOP Domain Coordinates for d2imn__:
Click to download the PDB-style file with coordinates for d2imn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2imn__:
- d2imn__ appears in SCOP 1.57
- d2imn__ appears in the current release, SCOPe 2.08, called d2imna_
View in 3D