Lineage for d2fgwh1 (2fgw H:1-124)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7688Species Fab H52 (synthetic, humanised version), kappa L chain [48769] (2 PDB entries)
  8. 7691Domain d2fgwh1: 2fgw H:1-124 [19855]
    Other proteins in same PDB: d2fgwh2, d2fgwl2

Details for d2fgwh1

PDB Entry: 2fgw (more details), 3 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d2fgwh1:

Sequence, based on SEQRES records: (download)

>d2fgwh1 b.1.1.1 (H:1-124) Immunoglobulin (variable domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsh
nqrfmdrftisvdkststaymqmnslraedtavyycarwrglnygfdvryfdvwgqgtlv
tvss

Sequence, based on observed residues (ATOM records): (download)

>d2fgwh1 b.1.1.1 (H:1-124) Immunoglobulin (variable domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsh
nqrfmdrftisvdkststaymqmnslraedtavyycarwrryfdvwgqgtlvtvss

SCOP Domain Coordinates for d2fgwh1:

Click to download the PDB-style file with coordinates for d2fgwh1.
(The format of our PDB-style files is described here.)

Timeline for d2fgwh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fgwh2