Lineage for d2fgwl1 (2fgw L:1-108)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219760Species Fab H52 (synthetic, humanised version), kappa L chain [48769] (2 PDB entries)
  8. 219764Domain d2fgwl1: 2fgw L:1-108 [19854]
    Other proteins in same PDB: d2fgwh2, d2fgwl2

Details for d2fgwl1

PDB Entry: 2fgw (more details), 3 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d2fgwl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgwl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlhsgvps
rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgqgtkveikr

SCOP Domain Coordinates for d2fgwl1:

Click to download the PDB-style file with coordinates for d2fgwl1.
(The format of our PDB-style files is described here.)

Timeline for d2fgwl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fgwl2