SCOP 1.55: Domain d2fgwl1: 2fgw L:1-108

Lineage for d2fgwl1 (2fgw L:1-108)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab H52 (synthetic, humanised version), kappa L chain [48769] (2 PDB entries)

8. Domain d2fgwl1: 2fgw L:1-108 [19854]
   Other proteins in same PDB: d2fgwh2, d2fgwl2

Details for d2fgwl1

PDB Entry: 2fgw, 3 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d2fgwl1:

Sequence; same for both SEQRES and ATOM records:

>d2fgwl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab H52 (synthetic, humanised version), kappa L chain}
diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlhsgvps
rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgqgtkveikr

Timeline for d2fgwl1:

• d2fgwl1 appears in SCOP 1.57
  
• d2fgwl1 appears in the current release, SCOPe 2.08