Lineage for d2fgwl1 (2fgw L:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740697Species Engineered (including hybrid species) [88533] (60 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2740772Domain d2fgwl1: 2fgw L:1-108 [19854]
    Other proteins in same PDB: d2fgwh1, d2fgwh2, d2fgwl2
    part of humanized Fab H52

Details for d2fgwl1

PDB Entry: 2fgw (more details), 3 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65
PDB Compounds: (L:) h52 fab (light chain)

SCOPe Domain Sequences for d2fgwl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgwl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlhsgvps
rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgqgtkveikr

SCOPe Domain Coordinates for d2fgwl1:

Click to download the PDB-style file with coordinates for d2fgwl1.
(The format of our PDB-style files is described here.)

Timeline for d2fgwl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fgwl2