Lineage for d2wpad1 (2wpa D:179-309)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003388Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2003401Protein Cyclin A [47956] (2 species)
  7. 2003437Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
    Uniprot P20248 175-432
  8. 2003630Domain d2wpad1: 2wpa D:179-309 [198539]
    Other proteins in same PDB: d2wpaa1, d2wpaa2, d2wpac1, d2wpac2
    automated match to d1vywb1
    complexed with 889, so4

Details for d2wpad1

PDB Entry: 2wpa (more details), 2.51 Å

PDB Description: optimisation of 6,6-dimethyl pyrrolo 3,4-c pyrazoles: identification of pha-793887, a potent cdk inhibitor suitable for intravenous dosing
PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d2wpad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wpad1 a.74.1.1 (D:179-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
hedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavny
idrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlv
lkvltfdlaap

SCOPe Domain Coordinates for d2wpad1:

Click to download the PDB-style file with coordinates for d2wpad1.
(The format of our PDB-style files is described here.)

Timeline for d2wpad1: