SCOPe 2.04: Domain d2wpad1: 2wpa D:179-309

Lineage for d2wpad1 (2wpa D:179-309)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (74 PDB entries)
   Uniprot P20248 175-432

8. Domain d2wpad1: 2wpa D:179-309 [198539]
   Other proteins in same PDB: d2wpaa_, d2wpac_
   automated match to d1vywb1
   complexed with 889, so4

Details for d2wpad1

PDB Entry: 2wpa, 2.51 Å

PDB Description: optimisation of 6,6-dimethyl pyrrolo 3,4-c pyrazoles: identification of pha-793887, a potent cdk inhibitor suitable for intravenous dosing

PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d2wpad1:

Sequence; same for both SEQRES and ATOM records:

>d2wpad1 a.74.1.1 (D:179-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
hedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavny
idrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlv
lkvltfdlaap

Timeline for d2wpad1:

• d2wpad1 first appeared in SCOPe 2.03
  
• d2wpad1 appears in SCOPe 2.05
  
• d2wpad1 appears in the current release, SCOPe 2.08