Lineage for d1fgvh_ (1fgv H:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287196Species Engineered (including hybrid species) [88562] (24 PDB entries)
  8. 287199Domain d1fgvh_: 1fgv H: [19853]
    Other proteins in same PDB: d1fgvl_
    part of humanized Fv H52

Details for d1fgvh_

PDB Entry: 1fgv (more details), 1.9 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

SCOP Domain Sequences for d1fgvh_:

Sequence, based on SEQRES records: (download)

>d1fgvh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
adsvkgrftisvdkskntlylqmnslraedtavyycarwrglnygfdvryfdvwgqgtlv
tvss

Sequence, based on observed residues (ATOM records): (download)

>d1fgvh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsy
adsvkgrftisvdkskntlylqmnslraedtavyycarwrgldvryfdvwgqgtlvtvss

SCOP Domain Coordinates for d1fgvh_:

Click to download the PDB-style file with coordinates for d1fgvh_.
(The format of our PDB-style files is described here.)

Timeline for d1fgvh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fgvl_