SCOPe 2.06: Domain d2wp9d_: 2wp9 D:

Lineage for d2wp9d_ (2wp9 D:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein Succinate dehydrogenase subunit SdhD [82872] (1 species)
   membrane anchor protein

7. Species Escherichia coli [TaxId:562] [82873] (6 PDB entries)

8. Domain d2wp9d_: 2wp9 D: [198528]
   Other proteins in same PDB: d2wp9a1, d2wp9a2, d2wp9a3, d2wp9b1, d2wp9b2, d2wp9c_, d2wp9e1, d2wp9e2, d2wp9e3, d2wp9f1, d2wp9f2, d2wp9g_, d2wp9i1, d2wp9i2, d2wp9i3, d2wp9j1, d2wp9j2, d2wp9k_
   automated match to d1nekd_
   complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wp9d_

PDB Entry: 2wp9, 2.7 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant

PDB Compounds: (D:) succinate dehydrogenase hydrophobic membrane anchor subunit

SCOPe Domain Sequences for d2wp9d_:

Sequence; same for both SEQRES and ATOM records:

>d2wp9d_ f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]}
ngvhdfilvrataivltlyiiymvgffatsgeltyevwigffasaftkvftllalfsili
hawigmwqvltdyvkplalrlmlqlvivvalvvyviygfvvvwgv

Timeline for d2wp9d_:

• d2wp9d_ first appeared in SCOPe 2.03
  
• d2wp9d_ appears in SCOPe 2.05
  
• d2wp9d_ appears in SCOPe 2.07
  
• d2wp9d_ appears in the current release, SCOPe 2.08