SCOP 1.73: Domain d1fgvl_: 1fgv L:

Lineage for d1fgvl_ (1fgv L:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (52 PDB entries)

8. Domain d1fgvl_: 1fgv L: [19852]
   Other proteins in same PDB: d1fgvh_
   part of humanized Fv H52

Details for d1fgvl_

PDB Entry: 1fgv, 1.9 Å

PDB Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65

PDB Compounds: (L:) h52 fv (light chain)

SCOP Domain Sequences for d1fgvl_:

Sequence; same for both SEQRES and ATOM records:

>d1fgvl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlesgvps
rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgagtkveik

Timeline for d1fgvl_:

• d1fgvl_ first appeared (with stable ids) in SCOP 1.55
  
• d1fgvl_ appears in SCOP 1.71
  
• d1fgvl_ appears in SCOP 1.75
  
• d1fgvl_ appears in the current release, SCOPe 2.08