Lineage for d2fbjh1 (2fbj H:1-118)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287316Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (47 PDB entries)
  8. 287324Domain d2fbjh1: 2fbj H:1-118 [19851]
    Other proteins in same PDB: d2fbjh2, d2fbjl1, d2fbjl2
    part of Fab J539
    complexed with fuc, nag, zn

Details for d2fbjh1

PDB Entry: 2fbj (more details), 1.95 Å

PDB Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution

SCOP Domain Sequences for d2fbjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
evkllesggglvqpggslklscaasgfdfskywmswvrqapgkglewigeihpdsgtiny
tpslkdkfiisrdnaknslylqmskvrsedtalyycarlhyygynaywgqgtlvtvsa

SCOP Domain Coordinates for d2fbjh1:

Click to download the PDB-style file with coordinates for d2fbjh1.
(The format of our PDB-style files is described here.)

Timeline for d2fbjh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fbjh2